PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC022275.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GATA
Protein Properties Length: 115aa    MW: 13062.9 Da    PI: 10.2467
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC022275.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.51.6e-17135135
          GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                  C +C + kTp+WR gp g+ktLCnaCG+++++ +l
  EcC022275.10  1 CLHCASEKTPQWRTGPMGPKTLCNACGVRFKSGRL 35
                  99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF003202.4E-15135IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.18E-14159No hitNo description
SMARTSM004019.5E-12145IPR000679Zinc finger, GATA-type
CDDcd002025.51E-12147No hitNo description
Gene3DG3DSA:3.30.50.102.5E-13133IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440126IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.358131IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006886Biological Processintracellular protein transport
GO:0055085Biological Processtransmembrane transport
GO:0031965Cellular Componentnuclear membrane
GO:0000166Molecular Functionnucleotide binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
CLHCASEKTP QWRTGPMGPK TLCNACGVRF KSGRLVPEYR PAASPTFVSA KHSNSHRKVL  60
ELRRQKELHR PHHHHHHHHQ PQQYFGQSPM FGMSAGGADE FLINHCGGPA YRHMI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010033845.19e-63PREDICTED: GATA transcription factor 12-like
SwissprotP697811e-47GAT12_ARATH; GATA transcription factor 12
TrEMBLA0A059AJU11e-62A0A059AJU1_EUCGR; Uncharacterized protein
STRINGVIT_09s0002g03750.t012e-53(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.12e-48GATA transcription factor 12